- Aquarium Supply
- Dog Leash
- Litter Cleanup & Sanitation
- Pet Bed & Furniture
- Pet Bowl & Feeding Accessory
- Pet Carrier & Travel Product
- Pet Clothing & Accessory
- Pet Collar
- Pet Food & Treat
- Pet Grooming Supply
- Pet Shelter & Cage
- Pet Toy
- Pet Training & Control Product
- Veterinary Equipment & Product Service
-
- Open-end Mini Trampoline
- Advantages at a glance• Unique in the world: the innovativehigh-performance jumping bed• Optimization of the sinking depth in the jumping bed center for a better security of the athlete• The new frame cover: efficient, safe and durable with new frame padd
Benao Inflatables (Guangzhou) Limited [Verified]
More >> -
- 10 Hole Blues Harp Harmonica
- The reed plate with electroplating antirust, the hole, reed gap is better after electroplating. 10 Hole Blues Harp Harmonica reed with rivet for tightness, so airtightness is better, the tone is more full. Use stainless steel screw, Corrosion resistance a
Jiangsu East Musical Instrument Co., Ltd [Verified]
More >> -
- C Turf Type Landscape Turf
- Check and Acceptance: Inspect the entire finished lawn as per concerned standards and requirement. If any defects found, correct it.
Win Industry Co. Ltd [Verified]
More >> -
- Drift Scooter
- Drift Scooter Item No. BL-KE13 Description: 36V 250W 360 Electric Kids Drift Scooter Your young rider will love our 360 Electric Three-Wheeler Electric Kids Drift Scooter, which features dual inclined rear caster wheels for great drifting and 360° spinnin
Bolaier Industry Co.,Limited [Verified]
More >> -
- Durable Pet Leash
- Model Number: CROP108 Brand Name: Nap Pet India Key Specifications/Special Features: Made ofleather materialNew pet premium collectionColor: according to buyer's demandDescription: dog lead quilted soft leatherFashionable and personalized design...
Shaoxing Sumu Gifts Co. Ltd [Verified]
More >> -
- Adjustable Dog Collars, Made of Leather
- Model Number: XR-P013-024-1 Brand Name: Xuerui Key Specifications/Special Features: FeatureAdjustable Dog Collars, Made of LeatherMaterial: leather or PU, metalSize: various sizes are availableColors: brown, black, pink, blue,redor customizedUsa...
Shanghai Xuerui Imp. & Exp. Co. Ltd(Pet Products Dept) [Verified]
More >> -
- Wholesale factory price aquarium fish tanks from original China
- Model Number: WB-007 aquarium fish tank-002 Brand Name: Yake Key Specifications/Special Features: Aquarium & accessory type: AquariumsFeature: Eco-friendly, stockedPlace of origin: Guangdong China (Mainland)Brand name: YKModel number: WB-0...
Xiongyihua Plastic Limited [Verified]
More >> -
- Blow moulding machine made large size round plastic fish bowl
- Model Number: WY030 Key Specifications/Special Features: Size: 4LMaterial: PETWeight: 159gOEM/ODM: yesVarious styles are available.You could design different artworks for the this fish bowl.Welcome you to inquire Shipping Information: FOB P...
Xiongyihua Plastic Limited [Verified]
More >> -
- Various sizes pet product attached to car seat belt for travel
- Model Number: SBB1214 Brand Name: Senful Pet Key Specifications/Special Features: SBB1214 Pet dog travel harnessLightweight and easy to fitSafest and most comfortable harness allows pet freedom of enjoying his natural habitat and outdoor activit...
Shanghai Senful Pet Products Co. Ltd [Verified]
More >> -
- Water Pump for Pond Swimming Pool DC for Solar or Submersible Pumping System
- Model Number: ZDB35-1 Brand Name: GORDON Key Specifications/Special Features: Pump:>>Pump body: cast iron and supports under special anti-rust treatment>>Impeller: stainless steel impeller, brass impeller, PPO impeller>>Mechani...
Fujian Gordon Pump Industry Co. Ltd [Verified]
More >> -
- High Quality Floating Fish Feed Pellet for Catfish
- Model Number: animal feed Brand Name: yatai Key Specifications/Special Features: Directions for Use1.Accordingtogrowthcycledeterminefeedingfeedtype,inordertomeetthecatfishdifferentgrowthstagesofnutritionalrequirements.2.Do"timing,point,quantitat...
Cangzhou Yatai Commercial & Trade Co . Ltd [Verified]
More >> -
- Florfenicol solution, against gram positive negative bacteria and mycoplasma
- Model Number: Fame-A1-204 Brand Name: sunvictor Key Specifications/Special Features: Used for infection in livestock and poultry caused by bacteriaAgainst both gram positive and gram negative bacteria and against mycoplasmaExport more than 100 t...
Shenyang Fame Biotechnology Co., Ltd. [Verified]
More >> -
- 100% natural chicken bites for dog treats
- Model Number: CC002-6 Brand Name: C&D Key Specifications/Special Features: Specification: 100% natural, only one ingredient of chicken breast inspect by USDA.High in protein, less than 9 calories per treat.Rich sources of nutrients promote y...
JIANGXI HUAHENG PET FOOD., LTD. [Verified]
More >> -
- Cat Scratcher with Toy
- Model Number: QT-PET-70 Brand Name: Q&T Key Specifications/Special Features: Keep your pet active with the Cat Scratcher. It has an extra-wide base for added stability and features a durable construction to withstand everyday wear and tear...
Ningbo Q&T Industrial Co. Ltd [Verified]
More >> -
- Dog dental chew treat braid
- Model Number: APC024-#2031 Key Specifications/Special Features: Our new hide twists with chicken meat are a traditional rawhide, perfect for dogs of all sizes. The long-lasting chews provide hours of entertainment, offering a natural way to sa...
JIANGXI HUAHENG PET FOOD., LTD. [Verified]
More >> -
- 100% Natural, Vegetable Based Dog Snack Chocolate Shape
- Model Number: ND-65 Key Specifications/Special Features: 100% natural, vegetable based dog snack chocolate shapeEntirely edibleHealthy and tastyIdeal for cleaning teethNo artificial colorings or additivesCOMPOSITIONRaw protein 1.5%Raw fat/oil 3....
JIANGXI HUAHENG PET FOOD., LTD. [Verified]
More >> -
- Solar or submersible pumping system automatic home booster pump for cold and hot water
- Model Number: PS-128D Brand Name: GORDON Key Specifications/Special Features: Pump:>>Pump body: cast iron and supports under special anti-rust treatment>>Impeller: stainless steel impeller, brass impeller, PPO impeller>>Mechani...
Fujian Gordon Pump Industry Co. Ltd [Verified]
More >> -
- Fashion Custom Dog Necklace Jewelry
- Model Number: Dog Necklace Jewelry-D1 Brand Name: J, J-jiaxing, Earbuds Key Specifications/Special Features: Type: dog necklace jewelryMaterial: metalSize: customizedColor: customizedEco-friendly: yesPacking: customizedOEM orders are welcomePa...
Jinjiang Jiaxing Groups Co. Ltd [Verified]
More >> -
- Prety Pet carriers bags with low price and good quality, OEM order welcomed
- Model Number: GR-PC-0029 Brand Name: GREEN Key Specifications/Special Features: Materials: Oxford clothLogo: OEMSizes: 40CM*20*224CMColor: Various colors availableGender: UnisexSample lead time:5-7 daysDelivery lead time: about 20-30days after s...
Shenzhen Thinkrace Technology Co., Ltd. [Verified]
More >> -
- Smoked pork hide pressed bone 75g dry process dog dental chews
- Model Number: PR01 Key Specifications/Special Features: Pork hide pressed bone - smoked 75g (dry process)Ingredients: pork hidePackaging: PVC+header card Shipping Information: Lead Time: 30 - ...
Jinjiang Jiaxing Home Co.,Ltd. [Verified]
More >>